Rabbit anti-Mouse Tspan18 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05253P

• Product Name:
• Rabbit anti-Mouse Tspan18 Polyclonal Antibody

• Synonym:
• 6720430O15; 2610042G18Rik; Tspan18

• Description:
• The antibody against Tspan18 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 149-248 of mouse Tspan18 (NP_899003.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 149-248 of mouse Tspan18 (NP_899003.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Tspan18

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• GVNGPEDFKLASVFRLLTLDTEEVPKACCRREPQTRDGVVLSREECQLGRNPFINKQGCYTVILNTFETYVYLAGAFAIGVLAIELFLMVFAMCLFRGIQ

• Gene ID:
• 241556

• Uniprot-ID:
• Q80WR1

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain, Rat brain