Rabbit anti-Mouse TROP-2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08469P

• Product Name:
• Rabbit anti-Mouse TROP-2 Polyclonal Antibody

• Synonym:
• Ly97; EGP-1; TROP2; GA733-1

• Description:
• The antibody against TROP-2 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 25-270 of mouse TROP-2 (NP_064431.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 25-270 of mouse TROP-2 (NP_064431.2).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TROP-2

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• QSNCTCPTNKMTVCDTNGPGGVCQCRAMGSQVLVDCSTLTSKCLLLKARMSARKSGRSLVMPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFQERYKLHPSFLSAVHYEEPTIQIELRQNASQKGLRDVDIADAAYYFERDIKGESLFMGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTAG

• Gene ID:
• 56753

• Uniprot-ID:
• Q8BGV3

• Purification Method:
• Affinity purification