Rabbit anti-Mouse Timm29 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07496P

• Product Name:
• Rabbit anti-Mouse Timm29 Polyclonal Antibody

• Synonym:
• TIM29; 1810026J23Rik; Timm29

• Description:
• The antibody against Timm29 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 157-266 of mouse Timm29 (NP_848734.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 157-266 of mouse Timm29 (NP_848734.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Timm29

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• YLQPRWVDFPGRILDVGFVGRWWILQNRMHDCDINDDEFLHLPAHLRVVAPHQLHSEANERLFEEKYKPIILTDDQVDQALWEEQVLQKERKDRLALSEADSLVQSDVSR

• Gene ID:
• 69773

• Uniprot-ID:
• Q8BGX2

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, A-549, PC-3, Mouse liver