Rabbit anti-Mouse Timm22 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07487P

• Product Name:
• Rabbit anti-Mouse Timm22 Polyclonal Antibody

• Synonym:
• Tim22; Timm22

• Description:
• The antibody against Timm22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-121 of mouse Timm22 (NP_062792.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 19-121 of mouse Timm22 (NP_062792.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Timm22

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• AEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIERAMESCAFKAVLACVGGFVLGGAFGIFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQR

• Gene ID:
• 56322

• Uniprot-ID:
• Q9CQ85

• Purification Method:
• Affinity purification

• Positive Samples:
• T47D, Mouse brain, Rat testis, Rat brain