Rabbit anti-Mouse STING Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12231P

• Product Name:
• Rabbit anti-Mouse STING Polyclonal Antibody

• Synonym:
• ERIS; MPYS; Mita; STING; Tmem173; STING-beta; 2610307O08Rik

• Description:
• The antibody against STING was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 280-371 of mouse STING. (NP_938023.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 280-371 of mouse STING. (NP_938023.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• STING

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• SREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKP

• Gene ID:
• 72512

• Uniprot-ID:
• Q3TBT3

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, A-549, RAW264.7