Rabbit anti-Mouse SLC16A11 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06841P

• Product Name:
• Rabbit anti-Mouse SLC16A11 Polyclonal Antibody

• Synonym:
• MCT 11; MNCb-2717; SLC16A11

• Description:
• The antibody against SLC16A11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse SLC16A11 (NP_694721.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse SLC16A11 (NP_694721.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SLC16A11

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• MTPKPAGPPDGGWGWVVAAAAFAVNGLSYGLLRSLGLALPDLAEHFERSAQDTAWVSALALAVQQAASPVGSALSTRWGARPVVMVGGVLTSLGLVFSAF

• Gene ID:
• 216867

• Purification Method:
• Affinity purification

• Positive Samples:
• U-937, Mouse liver, Mouse lung