Rabbit anti-Mouse SIRT6 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12313P

• Product Name:
• Rabbit anti-Mouse SIRT6 Polyclonal Antibody

• Synonym:
• Sir2l6; mSIRT6; 2810449N18Rik; SIRT6

• Description:
• The antibody against SIRT6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-294 of mouse SIRT6 (NP_001156902.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-294 of mouse SIRT6 (NP_001156902.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SIRT6

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• NLQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS

• Gene ID:
• 50721

• Uniprot-ID:
• Q8N6T7

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, 293T, Mouse spleen, Mouse stomach, A-549, LO2, BT-474, HL-60, Mouse heart