Rabbit anti-Mouse RNF138 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10916P

• Product Name:
• Rabbit anti-Mouse RNF138 Polyclonal Antibody

• Synonym:
• Trif; STRIN; Trif-d; 2410015A17Rik; 2810480D20Rik; RNF138

• Description:
• The antibody against RNF138 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-245 of mouse RNF138 (Q9CQE0) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 60-245 of mouse RNF138 (Q9CQE0).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RNF138

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• SVTRRERACPERALDLENIMRRFSGSCRCCSKKIKFYRMRHHYKSCKKYQDEYGVSSVIPNFKISQDSVRSSNRSETSASDNTETYQEDTSSSGHPTFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYGEFVNLQLDEETQYQTAVEESFQVNM

• Gene ID:
• 56515

• Purification Method:
• Affinity purification

• Positive Samples:
• BT-474