Rabbit anti-Mouse REG3G Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09900P

• Product Name:
• Rabbit anti-Mouse REG3G Polyclonal Antibody

• Synonym:
• REG-3-gamma; reg III-gamma; REG3G

• Description:
• The antibody against REG3G was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 27-174 of mouse REG3G (NP_035390.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 27-174 of mouse REG3G (NP_035390.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• REG3G

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA

• Gene ID:
• 19695

• Purification Method:
• Affinity purification

• Positive Samples:
• BxPC-3, U-87MG, Rat skeletal muscle