Rabbit anti-Mouse Prdm9 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00366P

• Product Name:
• Rabbit anti-Mouse Prdm9 Polyclonal Antibody

• Synonym:
• Rcr1; Dsbc1; repro7; Meisetz; PRDM9-B; G1-419-29; Prdm9

• Description:
• The antibody against Prdm9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 87-370 of mouse Prdm9 (NP_659058.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 87-370 of mouse Prdm9 (NP_659058.3).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Prdm9

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• DSEDSDEEWTPKQQVSPPWVPFRVKHSKQQKESSRMPFSGESNVKEGSGIENLLNTSGSEHVQKPVSSLEEGNTSGQHSGKKLKLRKKNVEVKMYRLRERKGLAYEEVSEPQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELLVWYGDEYGQELGIKWG

• Gene ID:
• 213389

• Uniprot-ID:
• Q96EQ9

• Purification Method:
• Affinity purification