Rabbit anti-Mouse PDHA2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04123P

• Product Name:
• Rabbit anti-Mouse PDHA2 Polyclonal Antibody

• Synonym:
• Pdhal; PDHA2

• Description:
• The antibody against PDHA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of mouse PDHA2 (NP_032837.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of mouse PDHA2 (NP_032837.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• PDHA2

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• ISYRSREEVHNVRSKSDPIMLLRERIISNNLSNIEELKEIDADVKKEVEDAAQFATTDPEPAVEDIANYLYHQDPPFEVRGAHKWLKYKSHS

• Gene ID:
• 18598

• Uniprot-ID:
• P35487

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse testis, Rat testis