Rabbit anti-Mouse p53 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07793P

• Product Name:
• Rabbit anti-Mouse p53 Polyclonal Antibody

• Synonym:
• bbl; bfy; bhy; p44; p53; Tp53

• Description:
• The antibody against p53 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 290-390 of mouse p53 (NP_035770.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 290-390 of mouse p53 (NP_035770.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• p53

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• EVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD

• Gene ID:
• 22059

• Uniprot-ID:
• P02340

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T