Rabbit anti-Mouse p19ARF Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08219P

• Product Name:
• Rabbit anti-Mouse p19ARF Polyclonal Antibody

• Synonym:
• Arf; p16; MTS1; Pctr1; p19ARF; p16INK4a; p19; ARF-INK4a; INK4a-ARF; Ink4a/Arf; p16(INK4a)

• Description:
• The antibody against p19ARF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse p19ARF (NP_034007.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse p19ARF (NP_034007.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• p19ARF

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSA

• Gene ID:
• 12578

• Uniprot-ID:
• Q64364

• Purification Method:
• Affinity purification

• Positive Samples:
• 293F