Rabbit anti-Mouse Nlrp6 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08089P

• Product Name:
• Rabbit anti-Mouse Nlrp6 Polyclonal Antibody

• Synonym:
• Avr; Navr; Nalp6; Pypaf5; Non-AVR; Navr/Avr; Nlrp6

• Description:
• The antibody against Nlrp6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 124-237 of mouse Nlrp6(NP_598707.2 ) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 124-237 of mouse Nlrp6(NP_598707.2 ).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Nlrp6

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• RQHAKVKERNARSVKINKRFTKLLIAPGTGAVEDELLGPLGEPEPERARRSDTHTFNRLFRGNDEESSQPLTVVLQGPAGIGKTMAAKKILYDWAAGKLYHSQVDFAFFMPCGE

• Gene ID:
• 101613

• Uniprot-ID:
• Q91WS2

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat colon