Rabbit anti-Mouse MLKL Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11939P

• Product Name:
• Rabbit anti-Mouse MLKL Polyclonal Antibody

• Synonym:
• 9130019I15Rik; MLKL

• Description:
• The antibody against MLKL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-53 of mouse MLKL (Q9D2Y4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-53 of mouse MLKL (Q9D2Y4).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MLKL

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNL

• Gene ID:
• 74568

• Purification Method:
• Affinity purification