Rabbit anti-Mouse Kdm6b Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12121P

• Product Name:
• Rabbit anti-Mouse Kdm6b Polyclonal Antibody

• Synonym:
• Jmjd3; 1700064E03Rik; Kdm6b

• Description:
• The antibody against Kdm6b was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-190 of mouse Kdm6b (NP_001017426.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 90-190 of mouse Kdm6b (NP_001017426.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Kdm6b

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA

• Gene ID:
• 216850

• Purification Method:
• Affinity purification

• Positive Samples:
• SH-SY5Y, K-562, mouse brain