Rabbit anti-Mouse KDM6A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12221P

• Product Name:
• Rabbit anti-Mouse KDM6A Polyclonal Antibody

• Synonym:
• Utx; KDM6A

• Description:
• The antibody against KDM6A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 550-700 of mouse KDM6A (NP_033509.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 550-700 of mouse KDM6A (NP_033509.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• KDM6A

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• MPSVSQPGVHTACPRQTLANGPFSAGHVPCSTSRTLGSTDTVLIGNNHVTGSGSNGNVPYLQRNAPTLPHNRTNLTSSTEEPWKNQLSNSTQGLHKGPSSHLAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLS

• Gene ID:
• 22289

• Purification Method:
• Affinity purification

• Positive Samples:
• T-47D, THP-1(negative)