Rabbit anti-Mouse IL33 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08495P

• Product Name:
• Rabbit anti-Mouse IL33 Polyclonal Antibody

• Synonym:
• Il-33; Il1f11; NF-HEV; 9230117N10Rik; IL-33

• Description:
• The antibody against IL33 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 109-266 of mouse IL33(NP_598536.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 109-266 of mouse IL33(NP_598536.2).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IL33

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

• Gene ID:
• 77125

• Uniprot-ID:
• Q8BVZ5

• Purification Method:
• Affinity purification

• Positive Samples:
• 293F transfected with IL33