Rabbit anti-Mouse IL18 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12299P

• Product Name:
• Rabbit anti-Mouse IL18 Polyclonal Antibody

• Synonym:
• Igif; Il-18; IL18

• Description:
• The antibody against IL18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 36-192 of mouse IL18 (NP_032386.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 36-192 of mouse IL18 (NP_032386.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IL18

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

• Gene ID:
• 16173

• Uniprot-ID:
• P70380

• Purification Method:
• Affinity purification

• Positive Samples:
• RAW264.7, Mouse spleen, Rat brain, Recombinant Human IL-18 Protein