Rabbit anti-Mouse Il15ra Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08365P

• Product Name:
• Rabbit anti-Mouse Il15ra Polyclonal Antibody

• Synonym:
• IL-15RA; Il15ra

• Description:
• The antibody against Il15ra was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 33-105 of mouse Il15ra(NP_032384.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 33-105 of mouse Il15ra(NP_032384.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Il15ra

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHY

• Gene ID:
• 16169

• Uniprot-ID:
• Q60819

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse liver