Rabbit anti-Mouse IL10 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07577P

• Product Name:
• Rabbit anti-Mouse IL10 Polyclonal Antibody

• Synonym:
• CSIF; If2a; Il-10; IL10

• Description:
• The antibody against IL10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-178 of mouse IL10 (NP_034678.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 19-178 of mouse IL10 (NP_034678.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IL10

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

• Gene ID:
• 16153

• Uniprot-ID:
• P18893

• Purification Method:
• Affinity purification

• Positive Samples:
• Recombinant Mouse IL-10 Protein