Rabbit anti-Mouse Hmox1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08114P

• Product Name:
• Rabbit anti-Mouse Hmox1 Polyclonal Antibody

• Synonym:
• HO1; HO-1; Hmox; Hemox; Hsp32; D8Wsu38e; Hmox1

• Description:
• The antibody against Hmox1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-266 of mouse Hmox1(NP_034572.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 1-266 of mouse Hmox1(NP_034572.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Hmox1

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• ERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQT

• Gene ID:
• 15368

• Uniprot-ID:
• P14901

• Purification Method:
• Affinity purification

• Positive Samples:
• NIH/3T3+arsenite, Mouse spleen, Rat spleen