Rabbit anti-Mouse Histone H1t Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07340P

• Product Name:
• Rabbit anti-Mouse Histone H1t Polyclonal Antibody

• Synonym:
• H1t; H1-6; H1.6; H1ft; Hist1h1t; Histone H1t

• Description:
• The antibody against Histone H1t was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 110-209 of mouse Histone H1t (NP_034507.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 110-209 of mouse Histone H1t (NP_034507.2).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Histone H1t

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• LSKKAASGNDKGKGKKSASAKAKKMGLPRASRSPKSSKTKAVKKPKATPTKASGSGRKTKGAKGVQQRKSPAKARAANPNSGKAKMVMQKTDLRKAAGRK

• Gene ID:
• 107970

• Uniprot-ID:
• Q07133

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse testis, Rat testis