Rabbit anti-Mouse GPS2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10463P

• Product Name:
• Rabbit anti-Mouse GPS2 Polyclonal Antibody

• Synonym:
• GPS-2; GPS2

• Description:
• The antibody against GPS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of mouse GPS2 (NP_062700.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of mouse GPS2 (NP_062700.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GPS2

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• TQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGSTLSLQKQMEHANQQTSFSDSSSLRPMHPQALHPAPGLLASPQLPVQIQAAGKSGFATTSQPGPRLPFIQHSQNPRFYHK

• Gene ID:
• 56310

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, SKOV3, A-431, SGC-7901, BxPC-3, Mouse lung, Mouse testis, Rat testis