Rabbit anti-Mouse GLI2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08406P

• Product Name:
• Rabbit anti-Mouse GLI2 Polyclonal Antibody

• Synonym:
• GLI2; CJS; HPE9; PHS2; THP1; THP2; Gli2

• Description:
• The antibody against GLI2 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 327-442 of mouse GLI2(NP_001074594.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 327-442 of mouse GLI2(NP_001074594.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GLI2

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• LTSISTMPTQLSSSSSNCLNDANQNKQNSESAVSSTVNPITIHKRSKVKTEAEGLRPASPLGLTQEQLADLKEDLDRDDCKQEAEVVIYETNCHWADCTKEYDTQEQLVHHINNEH

• Gene ID:
• 14633

• Uniprot-ID:
• Q0VGT2

• Purification Method:
• Affinity purification