Rabbit anti-Mouse G6PC Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11587P

• Product Name:
• Rabbit anti-Mouse G6PC Polyclonal Antibody

• Synonym:
• G6pt; G6pc1; G6Pase; Glc-6-Pase; G6PC

• Description:
• The antibody against G6PC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-112 of mouse G6PC (NP_032087.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-112 of mouse G6PC (NP_032087.2).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• G6PC

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• MEEGMNILHDFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGINLLWVAVVGDWFNLVFKWILFGQRPYWWVLDTDYYSNSSVPIIKQFPVTCETG

• Gene ID:
• 14377

• Uniprot-ID:
• P35576

• Purification Method:
• Affinity purification