Rabbit anti-Mouse FOXO3A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-13028P

• Product Name:
• Rabbit anti-Mouse FOXO3A Polyclonal Antibody

• Synonym:
• Fkhr2; FKHRL1; Foxo3a; 1110048B16Rik; 2010203A17Rik; FOXO3A

• Description:
• The antibody against FOXO3A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 558-635 of mouse FOXO3A (NP_062714.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 558-635 of mouse FOXO3A (NP_062714.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• FOXO3A

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• LSDSSSLGSAKHQQQSPASQSMQTLSDSLSGSSLYSASANLPVMGHDKFPSDLDLDMFNGSLECDMESIIRSELMDAD

• Gene ID:
• 56484

• Uniprot-ID:
• Q9WVH4

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Jurkat, 293T, PC-3