Rabbit anti-Mouse Enpp1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06862P

• Product Name:
• Rabbit anti-Mouse Enpp1 Polyclonal Antibody

• Synonym:
• Pca; ttw; twy; M6S1; NPP1; Npps; PC-1; Ly-41; Pca-1; Pdnp1; CD203c; E-NPP1; E-NPP 1; 4833416E15Rik; Enpp1

• Description:
• The antibody against Enpp1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 580-730 of mouse Enpp1 (NP_032839.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 580-730 of mouse Enpp1 (NP_032839.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Enpp1

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• PIYNPSHPKEEGFLSQCPIKSTSNDLGCTCDPWIVPIKDFEKQLNLTTEDDDIYHMTVPYGRPRILLKQHRVCLLQQQQFLTGYSLDLLMPLWASYTFLSNDQFSRDDFSNCLYQDLRIPLSPVHKCSYYKSNSKLSYGFLTPPRLNRVSN

• Gene ID:
• 18605

• Uniprot-ID:
• G3X9S2

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, 293T, Mouse kidney, Mouse liver