Rabbit anti-Mouse Cpsf4l Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00164P

• Product Name:
• Rabbit anti-Mouse Cpsf4l Polyclonal Antibody

• Synonym:
• D11Ertd636e; 0610010C04Rik; 1500000C01Rik; Cpsf4l

• Description:
• The antibody against Cpsf4l was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-228 of mouse Cpsf4l (NP_080958.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-228 of mouse Cpsf4l (NP_080958.2).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Cpsf4l

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• MEEVIAGLQGFTFAFELDVESQKGTGLLPFQGMDKSSSAVCNFFAKGLCVKGMLCPLRHEQGEKLVVCKHWLRGLCRKSDCCDFLHQYDVSKMPVCYFHSKFGNCSNKECLFLHLKPVLKLQDCPWYNQGFCKEVGPLCKYRHVHQVLCPNYFTGFCPEGPQCQFGHPKMSPPFHPSNVKLQPVNQPWDSTTSTGNTLVSPFQAKPMVHGQRRWSLPQACSSRAHPAP

• Gene ID:
• 52670

• Uniprot-ID:
• A6NMK7

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse testis, Mouse brain