Rabbit anti-Mouse CD68 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07513P

• Product Name:
• Rabbit anti-Mouse CD68 Polyclonal Antibody

• Synonym:
• Lamp4; gp110; Scard1; CD68

• Description:
• The antibody against CD68 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of mouse CD68 (NP_001277987.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 50-150 of mouse CD68 (NP_001277987.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD68

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• SHRPTTTSHGNVTVHTSSGPTTVTHNPATTTSHGNATISHATVSPTTNGTATSPRSSTVGPHPGPPPPSPSPRSKGALGNYTWANGSQPCVQLQAQIQIRI

• Gene ID:
• 12514

• Uniprot-ID:
• P31996

• Purification Method:
• Affinity purification

• Positive Samples:
• Raji, RAW264.7