Rabbit anti-Mouse CD168 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08211P

• Product Name:
• Rabbit anti-Mouse CD168 Polyclonal Antibody

• Synonym:
• HMMR; CD168; IHABP; RHAMM; hyaluronan mediated motility receptor

• Description:
• The antibody against CD168 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 716-794 of mouse CD168 (NP_038580.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 716-794 of mouse CD168 (NP_038580.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD168

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• QNLKQKIKHVVKLKDENSQLKSEVSKLRSQLVKRKQNELRLQGELDKALGIRHFDPSKAFCHASKENFTPLKEGNPNCC

• Gene ID:
• 15366

• Uniprot-ID:
• Q00547

• Purification Method:
• Affinity purification