Rabbit anti-Mouse Bcl9 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08472P

• Product Name:
• Rabbit anti-Mouse Bcl9 Polyclonal Antibody

• Synonym:
• Gm130; 2610202E01Rik; 8030475K17Rik; A330041G23Rik; Bcl9

• Description:
• The antibody against Bcl9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1278-1377 of mouse Bcl9 (NP_084209.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1278-1377 of mouse Bcl9 (NP_084209.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Bcl9

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• DQAPRMGLALPGMGGPGPVGTPDIPLGTSPSMPGHNPMRPPAFLQQGMMGPHHRMMSPAQSTVPGPATLMTNPAAAVGMIPGKDRGPAGLYTHPGPVGSP

• Gene ID:
• 77578

• Uniprot-ID:
• Q9D219

• Purification Method:
• Affinity purification

• Positive Samples:
• Karpas 299, Jurkat, 293T