Rabbit anti-Mouse BAF60a Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00851P

• Product Name:
• Rabbit anti-Mouse BAF60a Polyclonal Antibody

• Synonym:
• Baf60a; D15Kz1; BAF60a

• Description:
• The antibody against BAF60a was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of mouse BAF60a (NP_114030.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of mouse BAF60a (NP_114030.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• BAF60a

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• MAARAGFQSVAPSGGAGASGGAGVAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRN

• Gene ID:
• 83797

• Uniprot-ID:
• Q96GM5

• Purification Method:
• Affinity purification

• Positive Samples:
• SH-SY5Y, 293T, HepG2, BT-474, K-562, Mouse brain, Rat testis