Rabbit anti-Human ZNF521 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07548P

• Product Name:
• Rabbit anti-Human ZNF521 Polyclonal Antibody

• Synonym:
• EHZF; Evi3; ZNF521

• Description:
• The antibody against ZNF521 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-420 of human ZNF521 (NP_056276.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 210-420 of human ZNF521 (NP_056276.1).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ZNF521

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GFLSSSSLHGHMQVHERNKDGSQSGSRMEDWKMKDTQKCSQCEEGFDFPEDLQKHIAECHPECSPNEDRAALQCVYCHELFVEETSLMNHMEQVHSGEKKNSCSICSESFHTVEELYSHMDSHQQPESCNHSNSPSLVTVGYTSVSSTTPDSNLSVDSSTMVEAAPPIPKSRGRKRAAQQTPDMTGPSSKQAKVTYSCIYCNKQLFSSLAV

• Gene ID:
• 25925

• Uniprot-ID:
• Q96K83

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat brain