Rabbit anti-Human ZNF302 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01703P

• Product Name:
• Rabbit anti-Human ZNF302 Polyclonal Antibody

• Synonym:
• HSD16; MST154; ZNF327; MSTP154; ZNF135L; ZNF140L; ZNF302

• Description:
• The antibody against ZNF302 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 90-200 of human ZNF302 (NP_060913.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 90-200 of human ZNF302 (NP_060913.2).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ZNF302

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DEDSPQPVTMEKVVKQSYEFSNSNKNLEYTECDTFRSTFHSKSTLSEPQNNSAEGNSHKYDILKKNLSKKSVIKSERINGGKKLLNSNKSGAAFNQSKSLTLPQTCNREKI

• Gene ID:
• 55900

• Uniprot-ID:
• Q9NR11

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat testis