Rabbit anti-Human ZNF148 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09394P

• Product Name:
• Rabbit anti-Human ZNF148 Polyclonal Antibody

• Synonym:
• BERF-1; BFCOL1; GDACCF; ZBP-89; ZFP148; pHZ-52; HT-BETA; ZNF148

• Description:
• The antibody against ZNF148 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 690-794 of human ZNF148 (NP_068799.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 690-794 of human ZNF148 (NP_068799.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ZNF148

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG

• Gene ID:
• 7707

• Uniprot-ID:
• Q9UQR1

• Purification Method:
• Affinity purification

• Positive Samples:
• K-562, Mouse lung, Rat lung