Rabbit anti-Human ZNF141 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05448P

• Product Name:
• Rabbit anti-Human ZNF141 Polyclonal Antibody

• Synonym:
• D4S90; pHZ-44; ZNF141

• Description:
• The antibody against ZNF141 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 405-474 of human ZNF141 (NP_003432.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 405-474 of human ZNF141 (NP_003432.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ZNF141

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RRSTDRSQHKKIHSADKPYKCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIHT

• Gene ID:
• 7700

• Uniprot-ID:
• Q15928

• Purification Method:
• Affinity purification