Rabbit anti-Human ZNF134 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04872P

• Product Name:
• Rabbit anti-Human ZNF134 Polyclonal Antibody

• Synonym:
• pHZ-15; ZNF134

• Description:
• The antibody against ZNF134 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 73-170 of human ZNF134 (NP_003426.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 73-170 of human ZNF134 (NP_003426.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ZNF134

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HGLKLHTCGACGRQFWFSANLHQYQKCYSIEQPLRRDKSEASIVKNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFH

• Gene ID:
• 7693

• Uniprot-ID:
• P52741

• Purification Method:
• Affinity purification

• Positive Samples:
• 293F, U-251MG