Rabbit anti-Human Zip12 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-10021P

• Product Name:
• Rabbit anti-Human Zip12 Polyclonal Antibody

• Synonym:
• ZIP12; ZIP-12; LZT-Hs8; bA570F3.1; Zip12

• Description:
• The antibody against Zip12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC39A12 (NP_001138667.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC39A12 (NP_001138667.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Zip12

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGG

• Gene ID:
• 221074

• Uniprot-ID:
• Q504Y0

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, mouse brain, mouse eye, mouse lung, rat brain