Rabbit anti-Human ZC3H12D Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07150P

• Product Name:
• Rabbit anti-Human ZC3H12D Polyclonal Antibody

• Synonym:
• TFL; p34; MCPIP4; C6orf95; dJ281H8.1; ZC3H12D

• Description:
• The antibody against ZC3H12D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-230 of human ZC3H12D (NP_997243.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 150-230 of human ZC3H12D (NP_997243.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ZC3H12D

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMP

• Gene ID:
• 340152

• Uniprot-ID:
• A2A288

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, THP-1, Mouse spleen, Mouse liver, Rat spleen