Rabbit anti-Human ZC3H11A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06484P

• Product Name:
• Rabbit anti-Human ZC3H11A Polyclonal Antibody

• Synonym:
• ZC3HDC11A; ZC3H11A

• Description:
• The antibody against ZC3H11A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human ZC3H11A (NP_055642.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human ZC3H11A (NP_055642.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ZC3H11A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MPNQGEDCYFFFYSTCTKGDSCPFRHCEAAIGNETVCTLWQEGRCFRQVCRFRHMEIDKKRSEIPCYWENQPTGCQKLNCAFHHNRGRYVDGLFLPPSKTVLPTVPESPEEEVKASQLSVQQNKLSVQSNPSPQLRSVMKVESSENVPSPTHPPVVINAADDDEDDDDQFSEEGDETKTPTLQPTPEVHNGLRVTSVRKPAVNIKQGECLNFGIKTLEEIKSKKMKEKSKKQGEGSSGVSSLLLHPEPVPGPEKENVRTVVRTVTLSTKQ

• Gene ID:
• 9877

• Uniprot-ID:
• O75152

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, HeLa, Jurkat, MCF7