Rabbit anti-Human ZAK Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02550P

• Product Name:
• Rabbit anti-Human ZAK Polyclonal Antibody

• Synonym:
• pk; AZK; MLT; MRK; ZAK; CNM6; MLK7; MLTK; SFMMP; mlklak; MLTKbeta; MLTKalpha

• Description:
• The antibody against ZAK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human ZAK (NP_598407.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human ZAK (NP_598407.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ZAK

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPL

• Gene ID:
• 51776

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, A-549, HepG2, Mouse lung, Mouse heart, Rat brain