Rabbit anti-Human YWHAZ Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11654P

• Product Name:
• Rabbit anti-Human YWHAZ Polyclonal Antibody

• Synonym:
• HEL4; YWHAD; KCIP-1; HEL-S-3; POPCHAS; HEL-S-93; 14-3-3-zeta; YWHAZ

• Description:
• The antibody against YWHAZ was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 146-245 of human YWHAZ (NP_001129171.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 146-245 of human YWHAZ (NP_001129171.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• YWHAZ

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

• Gene ID:
• 7534

• Uniprot-ID:
• P63104

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, HeLa