Rabbit anti-Human Y14/RBM8A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-05259P

• Product Name:
• Rabbit anti-Human Y14/RBM8A Polyclonal Antibody

• Synonym:
• TAR; Y14; RBM8; ZNRP; RBM8B; ZRNP1; BOV-1A; BOV-1B; BOV-1C; MDS014; DEL1q21.1; C1DELq21.1; Y14/RBM8A

• Description:
• The antibody against Y14/RBM8A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Y14/Y14/RBM8A (NP_005096.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Y14/Y14/RBM8A (NP_005096.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Y14/RBM8A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGV

• Gene ID:
• 9939

• Uniprot-ID:
• Q9Y5S9

• Purification Method:
• Affinity purification

• Positive Samples:
• U251, HT-29, HepG2, HeLa, 293T, mouse brain, mouse heart, mouse kidney, rat liver