Rabbit anti-Human XPNPEP2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09020P

• Product Name:
• Rabbit anti-Human XPNPEP2 Polyclonal Antibody

• Synonym:
• APP2; AEACEI; XPNPEP2

• Description:
• The antibody against XPNPEP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-240 of human XPNPEP2 (NP_003390.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 22-240 of human XPNPEP2 (NP_003390.4).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• XPNPEP2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLS

• Gene ID:
• 7512

• Uniprot-ID:
• O43895

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, A-549, HepG2, HT-29, SW480, Mouse kidney, Mouse heart, Mouse small intestine, Rat kidney