Rabbit anti-Human WWOX Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09534P

• Product Name:
• Rabbit anti-Human WWOX Polyclonal Antibody

• Synonym:
• FOR; WOX1; DEE28; EIEE28; FRA16D; SCAR12; HHCMA56; PRO0128; SDR41C1; D16S432E; WWOX

• Description:
• The antibody against WWOX was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human WWOX (NP_057457.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human WWOX (NP_057457.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• WWOX

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGR

• Gene ID:
• 51741

• Uniprot-ID:
• Q9NZC7

• Purification Method:
• Affinity purification

• Positive Samples:
• SKOV3, LO2, HT-29, A-549, Jurkat