Rabbit anti-Human WSB1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02233P

• Product Name:
• Rabbit anti-Human WSB1 Polyclonal Antibody

• Synonym:
• SWIP1; WSB-1; WSB1

• Description:
• The antibody against WSB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 182-421 of human WSB1 (NP_056441.6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 182-421 of human WSB1 (NP_056441.6).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• WSB1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRVYIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAPLSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYRI

• Gene ID:
• 26118

• Uniprot-ID:
• Q9Y6I7

• Purification Method:
• Affinity purification

• Positive Samples:
• HT-29, A-549, HeLa, HepG2, SGC-7901