Rabbit anti-Human WNK1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-04328P

• Product Name:
• Rabbit anti-Human WNK1 Polyclonal Antibody

• Synonym:
• KDP; PSK; p65; HSN2; HSAN2; PRKWNK1; PPP1R167; WNK1

• Description:
• The antibody against WNK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human WNK1 (NP_055638.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human WNK1 (NP_055638.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• WNK1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPPARSGSGGGSAKEPQEERSQQQDDIEELETK

• Gene ID:
• 65125

• Uniprot-ID:
• Q9H4A3

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, A-549, SW620, HeLa