Rabbit anti-Human WDR77 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02664P

• Product Name:
• Rabbit anti-Human WDR77 Polyclonal Antibody

• Synonym:
• p44; MEP50; MEP-50; HKMT1069; Nbla10071; p44/Mep50; WDR77

• Description:
• The antibody against WDR77 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 153-243 of human WDR77 (NP_077007.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 153-243 of human WDR77 (NP_077007.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• WDR77

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTK

• Gene ID:
• 79084

• Uniprot-ID:
• Q9BQA1

• Purification Method:
• Affinity purification

• Positive Samples:
• U2OS, HeLa, 293T, Mouse brain