Rabbit anti-Human WDR4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-00253P

• Product Name:
• Rabbit anti-Human WDR4 Polyclonal Antibody

• Synonym:
• hWH; Wuho; MIGSB; TRM82; GAMOS6; TRMT82; WDR4

• Description:
• The antibody against WDR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-250 of human WDR4 (NP_061139.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 20-250 of human WDR4 (NP_061139.2).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• WDR4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRLELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIA

• Gene ID:
• 10785

• Uniprot-ID:
• P57081

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, HepG2, Rat lung